SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014748 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014748
Domain Number 1 Region: 9-100
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.02e-19
Family Calcium ATPase, transduction domain A 0.0018
Further Details:      
 
Domain Number 2 Region: 109-178
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000116
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014748   Gene: ENSCJAG00000007970   Transcript: ENSCJAT00000015562
Sequence length 228
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:50867328:50870579:-1 gene:ENSCJAG00000007970 transcript:ENSCJAT00000015562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLSMQVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVTGECMVNESSLTG
ESVPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTALLGTIYSI
FILHGNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLG
GKLQLVCFDKVGLQVGLAQGSGTATGTLARPQHPSYSLSSAHRTTGPV
Download sequence
Identical sequences F7IKZ9
ENSCJAP00000014748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]