SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015130 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015130
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-55
Family Necap1 N-terminal domain-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015130   Gene: ENSCJAG00000008146   Transcript: ENSCJAT00000015967
Sequence length 271
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:50746712:50765601:1 gene:ENSCJAG00000008146 transcript:ENSCJAT00000015967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQSPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRARPA
STGGLSLLPPPPGGRTSTLIPPPGEQLSVGGSLVQPAVAPTSDQLPARPNQAGFSSDLST
IFPHVTSGKELPHLGQRKEGEAFLSWPVFGT
Download sequence
Identical sequences F7DFL7
ENSCJAP00000015130 ENSCJAP00000015120 XP_008998739.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]