SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015195 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015195
Domain Number 1 Region: 148-479
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.08e-51
Family Pancreatic carboxypeptidases 0.0000993
Further Details:      
 
Domain Number 2 Region: 8-130
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0008
Further Details:      
 
Domain Number 3 Region: 479-567
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 9.61e-20
Family Carboxypeptidase regulatory domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015195   Gene: ENSCJAG00000008198   Transcript: ENSCJAT00000016037
Sequence length 592
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:111681428:111739681:-1 gene:ENSCJAG00000008198 transcript:ENSCJAT00000016037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLKIRAILSRDDIYDSDLSSGLVFRQSWWEQEGRREVSFLGVILHGRINILKSDWVTSYK
VMVSNDSHTWVTVKNGSGDMIFQGNSEKEIPILNELPVPMVARYIRVNPQSWFDNGSICM
RMEILGCPLPDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGK
SHQGLKLYAVEISDHPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFLCQEYLAHNAR
IVRLVEETRIHILPSLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEA
EDRQNVPRKVPNHYIAIPEWFLSENATVSQNTPHRIRHLRKSNYLLRGYLGRFFIEEESF
NYFLRSIWSFKTKTISPELHVSYYLYYLSHCWLHYLVYPLGLTTCVSLESFQCEEGYFRY
PSWFYLVGSLNDFSYLHTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGI
KGLVRDSHGKGIPNAIISVEGVNHDVRTANDGDYWRLLNPGEYAVTAKAEGFTASTKNCM
VGYDMGATRCDFTLSKTNMARIREIMEKFGKQPVSLPARRLKLRGRKRRQRG
Download sequence
Identical sequences F7H5D2
ENSCJAP00000015195 ENSCJAP00000015195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]