SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015964 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015964
Domain Number 1 Region: 21-211
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-41
Family beta-glycanases 0.00000000842
Further Details:      
 
Domain Number 2 Region: 286-353
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.43e-31
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.000065
Further Details:      
 
Domain Number 3 Region: 245-287
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000183
Family beta-glycanases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015964   Gene: ENSCJAG00000008613   Transcript: ENSCJAT00000016868
Sequence length 353
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:9243084:9247844:-1 gene:ENSCJAG00000008613 transcript:ENSCJAT00000016868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHTQWASDGAEYTIQANRTGTGIEYNIIRVPMASCDFSIRIYTYADTPDDFQLYNFSLPE
EDTRLKIPLIHRALQLSQRPISLCASPWTSPTWLKTNGAVNGKGSLKGQPGDTYHQTWAR
YFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANS
THRNVRLLMLDDQRLLLPHWAQVVLTDPEAALCGLQVLGAECAARLLGSRDAVQPQHHHE
PPVPRGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEKNDL
EAVALMHPDGSAVVVVLNRSSKDVPVTIEDPAVGFLETISPGYSIHTYLWRRQ
Download sequence
Identical sequences F7DB39
ENSCJAP00000015964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]