SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016022 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016022
Domain Number 1 Region: 137-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-31
Family C1 set domains (antibody constant domain-like) 0.00013
Further Details:      
 
Domain Number 2 Region: 23-150
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-31
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016022   Gene: ENSCJAG00000008714   Transcript: ENSCJAT00000016932
Sequence length 276
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:46321009:46616412:1 gene:ENSCJAG00000008714 transcript:ENSCJAT00000016932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPGFLWALVISTWLEFSIAQRVTQSESEMSVQEAETVTLSCTYDSSDSDYYLFWYKQS
PSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISGSQLGDTAMYFCAYRSTQSN
YRLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSNSSVCLFTDFDSKMNVSESKESEVYIT
DKTVLDMRSTDSKSNGAVAWSSNSNFKCTDAFNGSSLPANTFFSGSESLCDASLVEKSFE
TDMNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Download sequence
Identical sequences F6Y6F8
ENSCJAP00000016022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]