SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016252 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016252
Domain Number 1 Region: 64-308,416-478
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-40
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016252   Gene: ENSCJAG00000008850   Transcript: ENSCJAT00000017188
Sequence length 486
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:24198828:24208729:1 gene:ENSCJAG00000008850 transcript:ENSCJAT00000017188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRVLSLGVRRGPLTRRPGTLRGGFSLDWEEKLSEIKKKIQSVLPGTSLHPLYDSSHLP
PDHSDVVIVGGGVLGLSVAYWLKKLEKQRGALRVLVVERDLTYSQASSALSLGGIHQQFS
LPENIHLSLFSASFLRNINEHLAVVDAPPLDLQFNPLGYLWLASEKDAAAMENNVKVQRQ
EGAKVCLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSMGVLFCQ
GEVTRFVSSSDRMLTKNQKEVKLKRIYEVHVKMDNSVEYQPVECALVINAAGAWSAQIAA
LAGIGKGPPDTLQGTKLPVEPRKRYVYVWHCPQGPGLESPLVADTSGTYFRREGLGSNYL
GGRSPTEEEEPDPENLEVDHDFFQDKVWPHLAQRVPAFETLKVQNAWAGYYDYNTFDQNG
VVGPHPLVVNMFFATGFSGHGLQQAPGVGRAVAEMILEGRFQTINLDSFLFSRFYLGEKI
QEDNII
Download sequence
Identical sequences F6WV06
ENSCJAP00000016252 XP_002754618.1.60252 ENSCJAP00000016252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]