SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017274 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017274
Domain Number 1 Region: 62-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017274   Gene: ENSCJAG00000009439   Transcript: ENSCJAT00000018271
Sequence length 229
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:36983584:37034914:1 gene:ENSCJAG00000009439 transcript:ENSCJAT00000018271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSSTSSSTSSAAASSTKKDKKQMTEPEKPEAPAEPSGTGPGSGAHTGGSARPDAKEEQ
QQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYIL
LLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSL
ALDEPPCGQFALPGGGAGGPGICTCAVCKFPHLVPASLGLAAVQAQFSK
Download sequence
Identical sequences F7HLL4
ENSCJAP00000017274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]