SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017883 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000017883
Domain Number - Region: 113-202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000202
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017883   Gene: ENSCJAG00000009750   Transcript: ENSCJAT00000018909
Sequence length 394
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:29797907:29803199:-1 gene:ENSCJAG00000009750 transcript:ENSCJAT00000018909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSLPLGTGLGSEPLSHPPGAPREPDFVGPTVCPAAGEESTSPEQAQTLEQDALGPPEH
FQGGPRGNEPTACPPRWSTPGNVSLPISREVLFHHPASGLEVLEAEQDSLHLSLLGLGLQ
LQDLEQGPGRWALAQSGMVQLRALQADLRGAAERVEALITFGEGLAQRSEPGAWAALEQI
LRALGAHRDTIFRRLWQLQAQLVSYSLVFEEANTLDQDLEIEGDSDWPGPGGVWGPWAPS
SLPTSAELEWDPAGDIGGLGPLGQKTARILGAPCELCGHRGPQGRGQGLEEPHSSHSRQD
MLESSLSHRRKHLAGHRRRSLLRKPQDKKRQASPHLKDVRLEGNPGAPDPAPRWPLMVGA
MFLLPVSGGPCCFHARMPRIPYLVLSYVNGLPPV
Download sequence
Identical sequences F7IR86
ENSCJAP00000017883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]