SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017984 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017984
Domain Number 1 Region: 57-320
Classification Level Classification E-value
Superfamily Caspase-like 6.43e-78
Family Caspase catalytic domain 0.0000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017984   Gene: ENSCJAG00000009805   Transcript: ENSCJAT00000019011
Sequence length 321
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:2488843:2503722:-1 gene:ENSCJAG00000009805 transcript:ENSCJAT00000019011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADSMKKNQRMAGKMLLNTFFNIDQISPKKKGNSNMAVGPPETGESTDALKLCPHEEFLR
LCTEKAEEIYPIKERKDRTRLALIICNTEFDHLPPRHGADFDITGMRELLEGLDYSVVVE
EKLTARGMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHDDKNPDVLLYDTIFQ
IFNNRNCLGLRDKPKVIIVQACRGTNQGDLLVPDAPASLAVASSQSLKNLEEDAIHKTHV
EKDFIAFCSSTPHNVSWRDSTVGSIFITQLVACFRKYSWCCHLEEVFRKVQQSFETPRDK
AQMPTIERLSMTRYFYLFPGN
Download sequence
Identical sequences F7I505
ENSCJAP00000017984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]