SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018786 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018786
Domain Number 1 Region: 166-249
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.46e-19
Family HSP40/DnaJ peptide-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 47-119
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 3.66e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 22-55,122-164
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.06e-18
Family HSP40/DnaJ peptide-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018786   Gene: ENSCJAG00000010194   Transcript: ENSCJAT00000019844
Sequence length 312
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:2924459:2937992:1 gene:ENSCJAG00000010194 transcript:ENSCJAT00000019844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKK
GSVEKCPQCKGRGMQVHIQQIGPGMVQQIQTVCVECKGQGERINPKDRCESCHGAKVIRE
KKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKI
QLSEALCGFKKTLKTLDDRILVITSKAGEVVKHGDLKCVRDEGMPIYKAPLEKGILIIQF
LVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFSPSEQNWRQHREAYEEDE
DGPRAGVQCQTA
Download sequence
Identical sequences F7EB50
ENSCJAP00000018786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]