SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018872 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018872
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 590-728
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-31
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 1634-1788
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 6 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 5.91e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 7 Region: 1846-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 891-1045
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 9 Region: 1536-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-25
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 799-938
Classification Level Classification E-value
Superfamily Spectrin repeat 4.14e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 11 Region: 1440-1577
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 13 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 14 Region: 733-833
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-20
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 15 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 16 Region: 2005-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018872
Domain Number - Region: 1157-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.014
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018872   Gene: ENSCJAG00000010149   Transcript: ENSCJAT00000019934
Sequence length 2155
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:52858565:52966836:-1 gene:ENSCJAG00000010149 transcript:ENSCJAT00000019934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQRTSSISGPLSPAYTGQVPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENY
HDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLS
QDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSV
MRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEI
ANYRPTLDTLHEQANALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEGDACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSSHPSEKKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIRE
KTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAI
LSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNT
LTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKI
QKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLD
KWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKST
DEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLNAEAIRQRLADLKQL
WGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKK
HQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGK
LDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQE
RVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHD
AKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAA
YAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ
IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLL
QLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVE
KLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEA
ESQQQWDTSKGEQVSQNGLPAEQGSPRVSYRSQTYQNYKNFNSRRTASDQPWSGL
Download sequence
Identical sequences F7HG06
ENSCJAP00000018872 XP_003734780.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]