SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018892 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018892
Domain Number 1 Region: 552-738
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-53
Family DBL homology domain (DH-domain) 0.000000173
Further Details:      
 
Domain Number 2 Region: 746-873
Classification Level Classification E-value
Superfamily PH domain-like 5.87e-35
Family Pleckstrin-homology domain (PH domain) 0.000014
Further Details:      
 
Domain Number 3 Region: 240-381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 48-146
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000445
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018892   Gene: ENSCJAG00000010156   Transcript: ENSCJAT00000019955
Sequence length 985
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:127340871:127474777:-1 gene:ENSCJAG00000010156 transcript:ENSCJAT00000019955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDIAFLSGGRGKDDAWIITFPENCNFRCIPEEVIAKVLTYLTSIARQNGPDSRFTIILD
RRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVM
LSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELA
ETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHQ
QISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQELVTEVEFLLNQ
QAELADVTGTIAQVKQKIKKLENLDENSQELLAKAQFVILHGHKLAANHHYALDLICQRC
NELRYLSDILVNEIKAKRIQLSRTFKIHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQ
KALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG
FRNLADKHVRPVQFVVPTSENLIRSRAPFFSSKHGKKTWRQNQSNLKIEVVHDCPEKRSS
GPSSSLDNSNSLDVLKNHVLNELIQTERVYVRELFTVLLGYRAEMDNPEMFDLMPPLLRN
KKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGLCFLERKDDFQMYAKYCQNKPRSET
IWRKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSAQLKE
ALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFK
PMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEFVKGDNRKFEIWY
GEKEEVYIVQAPNVDVKMTWLKEIRNILLKQQELSTVKKRKQQDQLAEQDKIQISLQQND
EKQQGALINIEKTELEHPNTVVEVCEAIVSVQAEANTVWTEVSQSAEISEEPEEWSSNYF
HSTYGENEEEDRPLMRPVSEMALLF
Download sequence
Identical sequences F7HB09
ENSCJAP00000018892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]