SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018911 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018911
Domain Number 1 Region: 492-678
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-53
Family DBL homology domain (DH-domain) 0.000000173
Further Details:      
 
Domain Number 2 Region: 686-813
Classification Level Classification E-value
Superfamily PH domain-like 5.55e-35
Family Pleckstrin-homology domain (PH domain) 0.000014
Further Details:      
 
Domain Number 3 Region: 180-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000127
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018911
Domain Number - Region: 20-93
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00196
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018911   Gene: ENSCJAG00000010156   Transcript: ENSCJAT00000019973
Sequence length 925
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:127340871:127405907:-1 gene:ENSCJAG00000010156 transcript:ENSCJAT00000019973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEANPPRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVM
LSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELA
ETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHQ
QISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQELVTEVEFLLNQ
QAELADVTGTIAQVKQKIKKLENLDENSQELLAKAQFVILHGHKLAANHHYALDLICQRC
NELRYLSDILVNEIKAKRIQLSRTFKIHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQ
KALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG
FRNLADKHVRPVQFVVPTSENLIRSRAPFFSSKHGKKTWRQNQSNLKIEVVHDCPEKRSS
GPSSSLDNSNSLDVLKNHVLNELIQTERVYVRELFTVLLGYRAEMDNPEMFDLMPPLLRN
KKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGLCFLERKDDFQMYAKYCQNKPRSET
IWRKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSAQLKE
ALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFK
PMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEFVKGDNRKFEIWY
GEKEEVYIVQAPNVDVKMTWLKEIRNILLKQQELSTVKKRKQQDQLAEQDKIQISLQQND
EKQQGALINIEKTELEHPNTVVEVCEAIVSVQAEANTVWTEVSQSAEISEEPEEWSSNYF
HSTYGENEEEDRPLMRPVSEMALLF
Download sequence
Identical sequences F7H0I7
XP_002763382.1.60252 ENSCJAP00000018911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]