SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018921 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018921
Domain Number 1 Region: 526-645
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-39
Family Pleckstrin-homology domain (PH domain) 0.00000201
Further Details:      
 
Domain Number 2 Region: 194-348
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-28
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 35-138
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-24
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 329-414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000471
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018921   Gene: ENSCJAG00000010149   Transcript: ENSCJAT00000019985
Sequence length 699
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:52848972:52870390:-1 gene:ENSCJAG00000010149 transcript:ENSCJAT00000019985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHE
LGQDYEHVEMLQERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNE
AWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRM
HTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRV
RLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARND
SFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRD
ASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELL
EVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMADTV
DTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLN
RKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVA
LDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSR
AQTLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences F7H0F9
ENSCJAP00000018921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]