SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018933 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018933
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2191-2310
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-38
Family Pleckstrin-homology domain (PH domain) 0.00000201
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-31
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 5 Region: 1647-1801
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1011-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 7 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.63e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 8 Region: 1859-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 904-1058
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 10 Region: 812-951
Classification Level Classification E-value
Superfamily Spectrin repeat 4.59e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 11 Region: 1453-1590
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 14 Region: 746-846
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-20
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 15 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 16 Region: 2018-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000317
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018933
Domain Number - Region: 1170-1242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018933   Gene: ENSCJAG00000010149   Transcript: ENSCJAT00000019997
Sequence length 2364
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:52847334:53072649:-1 gene:ENSCJAG00000010149 transcript:ENSCJAT00000019997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTLDTLHEQANALPQEHAESPDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEGDACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSSHPSEKKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIQKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLNA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMADTVDTSEMVNGATEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences F7H0B6
ENSCJAP00000018872 ENSCJAP00000018933 XP_002757793.1.60252 XP_017819820.1.60252 XP_017819821.1.60252 XP_017819823.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]