SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018937 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018937
Domain Number 1 Region: 1938-2057
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-38
Family Pleckstrin-homology domain (PH domain) 0.00000201
Further Details:      
 
Domain Number 2 Region: 16-137
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 324-454
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-29
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 732-887
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 944-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 5.62e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 6 Region: 1580-1734
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 629-779
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 8 Region: 532-672
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 1174-1311
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 10 Region: 146-249
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1420-1525
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 1316-1417
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-22
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 13 Region: 250-358
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 14 Region: 1105-1203
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 15 Region: 1715-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018937
Domain Number - Region: 891-963
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0135
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018937   Gene: ENSCJAG00000010149   Transcript: ENSCJAT00000020001
Sequence length 2111
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:52848972:53072649:-1 gene:ENSCJAG00000010149 transcript:ENSCJAT00000020001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQ
QLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERL
EKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEA
ATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRA
RRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGI
QAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRR
LWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIK
EGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAW
MLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQANALPQEHAESPD
VRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEGDACELWIDEKEQWLNNMQIPE
KLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSSHPSEKKIKAQQDKLNTRWSQ
FRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLT
GMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLG
EASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQ
KMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTK
QAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDG
NINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQ
DMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIQKEGMQLISEKPETEAVVKEKLTGLH
KMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILL
KKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKH
NLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQP
RIDDIFERSQNIVTDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYF
DAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALV
ADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREV
VAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEW
KDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTV
ETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDA
CESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAE
IDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEV
HQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERL
TTLELLEVRRQQEEEERKRRPPSPEPSTKLPLNNLGGQRTASDQPWSGPFSRKHLSTQVI
AVTSSFQTSSPSGGILGCKAFIHSHVCESDTVDTSEMVNGATEQRTSSKESSPIPSPTSD
RKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQE
MGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDE
EMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDK
EKRFSLFGKKK
Download sequence
Identical sequences F7H0A9
ENSCJAP00000018937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]