SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018990 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018990
Domain Number 1 Region: 69-189
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.22e-26
Family Frizzled cysteine-rich domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018990   Gene: ENSCJAG00000010304   Transcript: ENSCJAT00000020060
Sequence length 787
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:117060722:117086649:-1 gene:ENSCJAG00000010304 transcript:ENSCJAT00000020060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATARPARGPELPLLGLLLLLLLGGPGRGAASSGNATGPEPRSAGGSARRSAAVTGPPPP
LSHCGRAASCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLQQIQLMVSCPSHPCPSLCTALSQTSLLLREVQHRFTMLARIVLIAWPPTAS
SPIFPIPSALRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGQKKKRRKRKKEVCPLAPPPELHPPAPAPSTVPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQGPFLPSAPAPMAWAHGRRQGLGPIHSRTNLMEAEL
MDADSDF
Download sequence
Identical sequences F7GPZ6
ENSCJAP00000018997 ENSCJAP00000018990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]