SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018997 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018997
Domain Number 1 Region: 69-189
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.22e-26
Family Frizzled cysteine-rich domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018997   Gene: ENSCJAG00000010304   Transcript: ENSCJAT00000020067
Sequence length 765
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:117060722:117086874:-1 gene:ENSCJAG00000010304 transcript:ENSCJAT00000020067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPPQPNMGPGFPKFAKLGLPLLGGPGRGAASSGNATGPEPRSAGGSARRSAAVTGPPPP
LSHCGRAASCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLWQQGLARPLPQTADSTDGVLVHKASVSVVSQTWQITSISASASLTDXTWCR
LTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPS
ADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGV
CPLAPPPELHPPAPAPSTVPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPS
PPQGPFLPSAPAPMAWAHGRRQGLGPIHSRTNLMEAELMDADSDF
Download sequence
Identical sequences F7GIH7
ENSCJAP00000018997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]