SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019140 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019140
Domain Number 1 Region: 301-474
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000942
Family YVTN repeat 0.047
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019140
Domain Number - Region: 171-226
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0312
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019140   Gene: ENSCJAG00000005718   Transcript: ENSCJAT00000020219
Sequence length 488
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:179222903:179257999:1 gene:ENSCJAG00000005718 transcript:ENSCJAT00000020219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLTEPLAAGSGEPAGPRRLGVVLPTNPEES
WQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVSLHGQSVEALDRVTPRPG
NFVSFLERGAIAIESDRARGARESGEMSHGTRQRQAIKAKMDELRPLIPVLEEYKADAKL
VLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPV
TVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHP
WSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDL
MVDESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNG
YSGGTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLF
HVIRSDEL
Download sequence
Identical sequences F6RAY1
ENSCJAP00000019140 ENSCJAP00000019140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]