SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019315 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000019315
Domain Number - Region: 10-106
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00131
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019315   Gene: ENSCJAG00000010462   Transcript: ENSCJAT00000020401
Sequence length 111
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:96465859:96471761:-1 gene:ENSCJAG00000010462 transcript:ENSCJAT00000020401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSALPSRGPENLQRPPLGPASRLGIPRPAMTAHSFALPVIIFTTFWGLIGIAGPWFVPK
GPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE
Download sequence
Identical sequences F6RWC4
ENSCJAP00000019315 ENSCJAP00000019315 XP_009001102.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]