SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019362 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019362
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 4.97e-19
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 99-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000115
Family SMI1/KNR4-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019362   Gene: ENSCJAG00000010459   Transcript: ENSCJAT00000020453
Sequence length 172
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:96961582:96993294:-1 gene:ENSCJAG00000010459 transcript:ENSCJAT00000020453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEDEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGTKWLEIQLLLTCLS
Download sequence
Identical sequences F6QP98
ENSCJAP00000019362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]