SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019630 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019630
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 4647-4806
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 3222-3382
Classification Level Classification E-value
Superfamily Spectrin repeat 6.52e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 4253-4370
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 3333-3488
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 5159-5235
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.22e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 2787-2944
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-22
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 9 Region: 4800-4916
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-22
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 4450-4588
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 4147-4261
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 3781-3925
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 1899-2035
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 14 Region: 3442-3587
Classification Level Classification E-value
Superfamily Spectrin repeat 8.49e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 15 Region: 3550-3704
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 16 Region: 4035-4152
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 17 Region: 4335-4440
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 18 Region: 5070-5150
Classification Level Classification E-value
Superfamily EF-hand 7.05e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 19 Region: 1224-1352,1379-1405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000258
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 3001-3161
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000381
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 21 Region: 2678-2798
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000452
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 22 Region: 2454-2577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000104
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 23 Region: 1764-1886
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000263
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 24 Region: 681-783
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 25 Region: 2224-2327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000353
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 4924-4996,5024-5053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000297
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 27 Region: 3706-3818
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000302
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 28 Region: 2009-2138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 2362-2466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000688
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 30 Region: 3930-4036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000461
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 31 Region: 1501-1658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000707
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 32 Region: 2109-2221
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000667
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 33 Region: 2586-2705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000981
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 34 Region: 749-866
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000048
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 35 Region: 596-679
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000533
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 36 Region: 1424-1539
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019630
Domain Number - Region: 3136-3214
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00417
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019630   Gene: ENSCJAG00000002323   Transcript: ENSCJAT00000020749
Sequence length 5427
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:73498872:73910158:1 gene:ENSCJAG00000002323 transcript:ENSCJAT00000020749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTIHLKAEPLTKATHSSSTSWFRKPMTRAELWLSAPLKMKAISDLCMNYCLGEEMQM
KLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFRTSYAETLGKL
ETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKRNY
FSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQH
MKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIHS
KSSVASLVGRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQRT
KWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWN
YLRKDLDLIQTWNLEKLRSSAPGECQQIMKNLQGHFEDFLQDSRDSVLFSVADRLRLEEE
VEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVIKRIQSLASSRTDK
DAREDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEK
MDHVYGLSTVYLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALEAHRSTLR
HWLSDVKDKNSVFSVLDEEIAKAKAVVEQMSRLTSERNLDLERYQEKGSQLQERWHRVIA
QLEIRQSELEGIQEVLGDYRTCHGTLIKWIEATTTQQEMMKPGQAEDSRVLSEQLSQQTD
LFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAI
TQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQAHVEKVKELLGWVSSL
ARNTQGKATSSQIKESTDIEKAILEQQVLAEELTTKREQVSEAIKTSQIFLAKHGHKLSE
KEKEQISDQLNALNKTYHDLCDGSANQLQQLQSQLAHQTEQKTLQKQRNTCHQKLEDLCS
WVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNHVTSFATVVKDIEGFMEENQ
TKLSPYELTALREKLHQAKEQYEALQEQTRVAQKELEEAVTSVLQQETEKSKAAKELAEN
KKKIDALLEWVTSVGSSDGQLLTNLPGMEQFSGASLEKGALDTTDGYMGVNQAPEKLDKQ
CEKMKARHRELLSQQQNFILATQSAQAFLDQHGYNLTPEEQQMLQEKLGELKEQYSTSLT
QSEAELKRMQTLQDELQKFLQDHREFESWLERSEKELENMHKGGSSPKALPSLLKRQGSF
SEDVISHKGDLRFVTISGQKVLDTENSFKEGKEPSEIGNLVRDKLQDATERYTALHSKCT
RLGSHLNMLLGQYHQFQNSADSLQAWMQTCEANVEKLLSDTVASDPGVLQEQLATTKQLQ
EELAEHQVPVEKLQKVARDIMEIEGEPAPDHKHVQETTDSIFSHFQSLSYSLAERSALLQ
KAIAQSQSVQESLETLLQSIGEVEQNLEGNQVASLSSGVIQEALATNMKLKQDIARQKSS
LEATREMVTRFMETADGTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFEH
LSDKLQQFMENKSRMLASGNQPDQDIAHFFQQIQELSLEMEDQQENLDTLEHLVTELSSC
GFALDLSQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETEG
SIPPTETSMSAKELEKQIEYLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQGK
TGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHESQESLQAVLNKME
EVQKEANSVLQWLESKEKVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKVK
EALAGLLVTYPNSQEAENWKKIQEELNYRWERATELTVARQRQLEESASHLAYFQAAESQ
LRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILMGP
GDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVKTVG
QRLSGQSAISTQPEAVKQQLEETSEIRSDLEQLDQEVKEAQTLCDELSVLIGEQYLKDEL
KKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQTKNCPIS
AKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKNH
WEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWVEDCKAKMSELRVTLDPVQLESSLL
RSKAMLSEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAITEELQAKTG
SLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQALE
PQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIGQ
FHCRVREMFSQLADLDDELDGMGAVGRDTDSLQSQIEDVRLFLNKIQVLKLDIEASEVEC
RHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEEFYRKLKGLNDA
TTGAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKD
CDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIA
NQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAEVADREKITGQLE
SLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAK
IQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSAEQGVLSEKIDSLQARYREIQDR
CCRKAALLDQALANARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHKQHADHLALN
EEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQA
RQLATKFQSTYEELTGWLREVEGELAANGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLD
TVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQAA
DAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFG
TCGEEQKAVLQEKTESLIEQYEAISLLNSDRYARLERAQVLVNQFWETYEELSPWIEETR
TLIAQLPPPAIDHEQLRHQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGKMVEE
KYQNAENMYAQIKEEVRQRALALDEAVSQSAQITEFHDKIEPMLETLENLSSRLRMPPLI
PAEVDKIRECISENKSATVELEKLQPSFEALKHRGEELIGRSQGADKDLAAKEIQDKLDQ
MVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSII
KQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKT
WKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFK
VEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEG
ALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATV
ETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSE
IEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLML
LSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTL
AEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVL
IKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEI
SNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLSEDTQKLDNFLGEVRD
KWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNL
MDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSK
QSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQTLIDTHKEFMKKVE
EKRVDVNSAVAMGEILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELV
ANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVT
KTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWL
LALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKI
TRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADK
IEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEF
LVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQS
NHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTN
RADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRR
GLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences F6TYV0
ENSCJAP00000019630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]