SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019652 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019652
Domain Number 1 Region: 261-366
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-33
Family Calponin-homology domain, CH-domain 0.00000789
Further Details:      
 
Domain Number 2 Region: 382-498
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 816-893
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000979
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 4 Region: 723-813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000968
Family Spectrin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019652   Gene: ENSCJAG00000010349   Transcript: ENSCJAT00000020771
Sequence length 903
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:58016513:58071076:-1 gene:ENSCJAG00000010349 transcript:ENSCJAT00000020771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVCGCVRAEKEEQYVDPAKTPLNPEKYSPGRKYFRRKPIKKTGSDKESVEENNENEGK
KRSSSQPSKEQPAPSSRGLVQQESVTPNSALGDGIQQKKTEVRADSVKQKLLPSAVSSWS
DHVKTSPAKDSDIEVKVGELDERISEDSTSYCTKGKKHLDDGNTSEITFQEKIDVLSFRK
AASLSSIPSGIAISLEKSGFAEDTSESYSSIQERQNIERFCPHETEHFQFKKRRCHSLCT
SVFSASKNTDGNEISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRDGKL
FNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVIT
YVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPIE
LKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEWGKL
IIAMLEREKALRPEVERLEMLQQIASRVQRDSVICEDKLILARNALQSDSKRLESGVQFQ
NEAEIAGYILECENLLRQHVIDVQILIDGKYYQVDQLVQRVAKLRDEIMALRNECSSVYS
KGRMLTTEQTKLMISGITQSLNSGFAQTLHPSLSSGLTQSLTPSLTSSSITSGLSSGMTS
RLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINM
KFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQM
TAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLVTLHNFVSRATNELIWLNEKEEEEVAY
DWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEVSQKVMVL
VKY
Download sequence
Identical sequences F6TCM2
ENSCJAP00000019652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]