SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019686 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019686
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 243-289
Classification Level Classification E-value
Superfamily UBA-like 0.0000001
Family CUE domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019686   Gene: ENSCJAG00000010681   Transcript: ENSCJAT00000020805
Sequence length 472
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:102602313:102618215:1 gene:ENSCJAG00000010681 transcript:ENSCJAT00000020805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAATAPQPPPASQPSQPPP
PRPAAELAAAAALRWTSEPQPGALQAQLAKPDLAEERLGDGSSADNTEVFSDKDTDQRSS
PDVTKNKGCFTPESPEIVSVDEGGYAVQKNGGNPESRPDSPKYHVEQNHLLIEGPSGTVS
LPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERTSA
EPESLMLPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPNPLAMPLQH
PFPQPPRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFR
SSPVLPARATEDPRISIPDDGCPIVSKQSMYTEDDYDERSDSSDSRILNTSS
Download sequence
Identical sequences F6SQD3
XP_002742969.1.60252 ENSCJAP00000019686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]