SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019726 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019726
Domain Number 1 Region: 2391-2633
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-66
Family Plakin repeat 0.0000086
Further Details:      
 
Domain Number 2 Region: 2087-2321
Classification Level Classification E-value
Superfamily Plakin repeat 1.24e-61
Family Plakin repeat 0.00000395
Further Details:      
 
Domain Number 3 Region: 374-476
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 909-1037,1064-1092
Classification Level Classification E-value
Superfamily Spectrin repeat 2.96e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 5 Region: 2334-2417
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000068
Family Plakin repeat 0.016
Further Details:      
 
Domain Number 6 Region: 281-371
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000389
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 7 Region: 449-556,677-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019726
Domain Number - Region: 1383-1489
Classification Level Classification E-value
Superfamily Tropomyosin 0.000324
Family Tropomyosin 0.0023
Further Details:      
 
Domain Number - Region: 703-844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00843
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019726   Gene: ENSCJAG00000010349   Transcript: ENSCJAT00000020848
Sequence length 2647
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:57992417:58020519:-1 gene:ENSCJAG00000010349 transcript:ENSCJAT00000020848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSYSYRSSDSVFSNTTSTRTSLDSNENLLSVHCGPTLINSCISFGNESFDGHRLEMLQ
QIASRVQRDSVICEDKLILARNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVID
VQILIDGKYYQVDQLVQRVAKLRDEIMALRNECSSVYSKGRMLTTEQTKLMISGITQSLN
SGFAQTLHPSLSSGLTQSLTPSLTSSSITSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNF
SSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEW
GSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKL
LNTSRNQERHLVTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRE
LDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAY
FEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTVASL
MGKAKTVIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISP
TGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEID
RIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQY
YQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRIT
EQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPMLRSELNVVLQNMNQVYSMSSTY
IDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIQNLISTLKQWRSEVDEKRQ
VFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEG
IGKSLKYYRDTYHPLDDWIQQVETNQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSK
MDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRY
TALVTLMTQYIKFAGDSLKRLEEEEIKKYKETSEHGAYSDLLQRQKATMLENSKLTGKIR
ELERMLAELKKQKSRVEEELPKVREAAENELRRQQRNVEDMSLQKIRAESEAKQYRRELE
TIVREKEAAERELERVRQLTIEAEAKRAAVEENLLNFRNQLEENTFTRRTLEDHLKRKDL
SLNDLEQQKNKLMEELRRKRDNEEELLKLVKQMEKDLAFQKQVAEKELKEKQRIELEARR
RITGTQYSCRENALPMCGVTPATSCRAVTGLQQEHDKQKAEELKQQVDELTAANRKAEQD
MRELTYELSALQLEKSSSEEKARLLKDKLDETNNTLRCLKLELERKDQAEKGYSQQLREL
GRQLNQTTGKAEEAMQEANDLKKIKHNYQLELESLHHEKGKLQREVDRVTRAHAAAEKNI
QHLNSQIHFFKDEKELERLRICQRKSDHLKEQFEKSHEQLLQNIKAEKENNDKIQRLNEE
LEKSNECAEMLKQKVEELTRQNNETKLMMQKIQAESENIALEKQTIQQRCEALKIQADGF
KDQLRNTNEHLHKQTKTEQDFQRKIKCLEEDLAKSQNLVSEFKQKCDQQNIIIQNTEKEV
RNLNAELNASKEEKRRGEQKVQLQQAQVQELNNRLKKVQDELHLKTIEEQMTHRKMVLFQ
EESAKFKQSAEEFRKKMEKLMESKVITENDISGIKLDFVSLQQENCRAQENAKLCETNIK
ELERQLQQYREQMQQGQHVEANHYQKCRKLEDELIAQKCEVENLKQKMDQQIKEHEHQLV
LLQCEIQKKNMAKDCTFKPDFEMTVKECQHSGEVSSRNTGHIHPTPRSPLLRWTQEPQPL
EEKWQHRVEQIPKEVQFQPPGAPLEKEKSQQCYSEYFSQTSTELQITFDETNPVTRLSEI
EKIRDQALNHSRPPVRYQDNACEMELVKLLTPLEIAKNKQYDMHTEVTTLKQEKNPVPSA
EEWMLEGCRASGGLKKGDLLKKGLEPETFQNIDGDHASSVRDDEFKFQGLRHTVTARQLV
EAKLLDMRTIEQLRLGLKTVEEVQKTLNKFLTKATSIAGLYLESTKEKVSFASAAKRIII
DKMMALAFLEAQAATGFIIDPISGQTYSVEDAVLKGVVDPEFRIRLLEAEKAAVGYSYSS
KTLSVFQAMENRMLDRQKGKHILETQIASGGIIDPVRGIRVPPEIALQQGLLNNAILQFL
HEPSSNTRVFPNPNNKQALYYSELLRMCVFDVKSQCFLLPFGERNISNLNVEKTHRISVV
DTKTGAELTAYEAFQRNLIEKSMYLELSGQQYQWKEATFFESYGHSSHMLTDTKTGLHFN
INEAIEQGTIDKSLVRKYQEGLITLTELADALLSRLVPKKDLHSPIAGYWLTASGERISV
LKASRRNLVDRITALRCLEAQVSTGGIIDPLTGKKYRVAEALHRGLVDEGFAQQLRQCEL
VITGIGHPITNKMMSVVEAVNANIINKEMGIRCLEFQYLTGGLIEPQVHSRLSIEEALQV
GMIDVLIATKLKDQKSYVRNIICPQTKRKLTYKEALEKADFDFHTGLKLLEVSEPLMTGI
SSLYYSS
Download sequence
Identical sequences F6XJZ9
ENSCJAP00000019726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]