SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019964 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019964
Domain Number 1 Region: 114-440
Classification Level Classification E-value
Superfamily RNI-like 6.02e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Domain Number 2 Region: 65-115
Classification Level Classification E-value
Superfamily F-box domain 1.44e-17
Family F-box domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019964   Gene: ENSCJAG00000010823   Transcript: ENSCJAT00000021097
Sequence length 449
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:187499141:187510805:-1 gene:ENSCJAG00000010823 transcript:ENSCJAT00000021097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIR
LASRPQKEQASIDRLPDHSVVHIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGE
TINVDRALKVLSRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYIISQCCPELRRLEVSGC
YNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDC
FVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGL
REIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCT
KLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQ
DCEVSVEALRFVKRHCKRCVIEHTNPAFF
Download sequence
Identical sequences F6Z844
ENSCJAP00000019964 ENSCJAP00000019964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]