SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020113 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020113
Domain Number 1 Region: 43-565
Classification Level Classification E-value
Superfamily SIS domain 8.62e-214
Family Phosphoglucose isomerase, PGI 0.00000000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020113   Gene: ENSCJAG00000010910   Transcript: ENSCJAT00000021252
Sequence length 569
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:28683732:28718054:1 gene:ENSCJAG00000010910 transcript:ENSCJAT00000021252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALCSLQLLGCDDPRALLTLPTATMGERPAKRLLKSPTMAALTRDPQFQKLQQWYREHG
SELNLRRLFDTDEERFNHFSLTLNTNHGHILVDYSKNLVTEEVMRMLVDLAKSRGVETAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQGPLMVTE
ALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWF
LQVAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVG
FDNFEQLLSGAHWMDQHFRTTPLEKNAPILLALLGIWYINCFGCETHAMLPYDQYLHRFA
AYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIP
VQTQHPIRKGLHHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLEKLLPHKVFE
GNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPEL
DGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences F7GRS3
ENSCJAP00000019301 ENSCJAP00000020113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]