SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020179 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020179
Domain Number 1 Region: 1848-2085
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-51
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 962-1093
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 3 Region: 445-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000196
Family EGF-type module 0.00048
Further Details:      
 
Domain Number 4 Region: 521-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000274
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 483-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000876
Family EGF-type module 0.00095
Further Details:      
 
Domain Number 6 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000438
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 525-638
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000503
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 1187-1304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 10 Region: 777-903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000182
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 12 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 898-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000762
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 14 Region: 412-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.00087
Further Details:      
 
Domain Number 15 Region: 622-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000129
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 16 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000267
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 18 Region: 332-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 19 Region: 1480-1513
Classification Level Classification E-value
Superfamily Notch domain 0.000000144
Family Notch domain 0.0052
Further Details:      
 
Domain Number 20 Region: 1520-1552
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 21 Region: 59-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 1138-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000783
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 1439-1471
Classification Level Classification E-value
Superfamily Notch domain 0.00000549
Family Notch domain 0.00021
Further Details:      
 
Domain Number 24 Region: 1105-1141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.016
Further Details:      
 
Domain Number 25 Region: 1381-1419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00003
Family EGF-type module 0.016
Further Details:      
 
Domain Number 26 Region: 1300-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000020179
Domain Number - Region: 937-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000182
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1336-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 29-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0434
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020179   Gene: ENSCJAG00000010922   Transcript: ENSCJAT00000021319
Sequence length 2524
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:180621925:180675135:-1 gene:ENSCJAG00000010922 transcript:ENSCJAT00000021319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARAPLRCSQPGETCLNGGKCEANGTEACVCGGAFVGLRCQDS
NPCLSTPCKNAGTCHVVDRGGMADYVCSCPLGFSGPLCLTPLDNACLSNPCRNGGTCDLL
TLTEYKCRCPPGWSGKLCQQADPCASNPCANGGQCLPFDASYICHCPPSFHGPTCRQDVN
ECSQNPGPCRHGGTCHNEVGSYHCTCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFTGQNCEENIDDCPENKCKNGGTCVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHHTTRATKTPTTRVPMQKKPIRPKPSGARGPVQPLTCVPSPGSHPCEHAG
KCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGMHC
EVNTDECASSPCLHSGRCLDKINEFQCECLMGFTGHLCQYDVDECASTPCKNGAKCLDGP
NTYTCVCTEGYTGTHCEVDIDECDPDPCHYGTCKDGVSTFTCLCRPGYTGHHCETNINEC
SSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSTCLDKIDGYECACEP
GYTGSMCNIDIDECAGSPCHNGGTCEDGVNSFTCRCPEGYHDPTCLSEVNECNSNPCVHG
ACRDSLNGYAQGPPPPXSGTNWDINNECESNPCVNGGCRDMTGGYVCTCREGFQRGPNCQ
TNINECASNPCLNQGTCIDDIAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRESED
YESFSCVCPTGWQGGQTCEVDINECVKSPCQHGASCQNTQGSYRCHCQAGYSGRNCETDI
DDCRPNPCHNGGSCTDGVNMAFCDCLPGFQGTFCEEDINECASDPCRNGANCTDCVDSYT
CTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQ
PCLHGGTCQDSCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSG
WTGLYCDVPSVSCEVAAQRQGVDIAHLCQHGGLCVDTGNTHHCRCQAGYMGSYCEDLVDE
CSPSPCQNGATCTDYLGGYSCKCVATHQALTASWHRGEDLIGPXQNGGTCLDLPNTYKCS
CPRGTQGVHCEINVDDCNPAMDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDV
NECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNT
ARGFICKCPSGFEGATWENDARACGQPCAAFNGGTCIGPRSPTCLCLGPFTGPECQFPTS
SPCLGGNPCYNQGTCEPTSEPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPQIEEAC
ELPECREDSGNKACSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGRCDSQC
NSAGCLFDGFDCQRVEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERL
AAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDANGQQMIFPYYGREEELRKH
PIKRAAEGWAAPGSLLGQVKASLLPGGRRRRELDPMDIRGSIVYLEIDNRQCVQASSQCF
QSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCG
VLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDSGLRGS
WSHPVLPAMPSWVMLQADSAPLGAAAPLPWAAAGHRPSRLNTIASAPADGFTPLMIASCS
GGGLEMGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEAS
ADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGML
EDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAARE
GSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSPQLHGAPLGG
TPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACSGKETKDLKVRRKKSQDGKGCLL
DNSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLTHLPGMPDTHLGIGHLNVAA
KPEIAALGGGGQLAFEAGPPRLSHLPVASGTSTVLGSSSGGAVNFTVGGSTGLNGQCEWL
SRLQSRLVPSQYNPLRGGVVPGPLSSQAPSLQHSMVGPLHSGLAASTVPQMMSYQGLPST
RLATQPHLVQTQQVQPQNLQMQPQNLQPPNIQQQQSLQPPLPPQPHLSVSSSASGHLGRS
FLSGEPSQADVQPLGPSSLAPHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSS
SPVDNTPSHQLQVPEHPFLTPSPESPDPWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIP
EAFK
Download sequence
Identical sequences F7GB19
ENSCJAP00000020179 ENSCJAP00000020179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]