SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020354 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020354
Domain Number 1 Region: 1279-1458
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 1465-1585
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-34
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 3 Region: 277-413
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-18
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 4 Region: 1097-1234
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 5 Region: 499-640
Classification Level Classification E-value
Superfamily Spectrin repeat 9.56e-18
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 6 Region: 841-1000
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000224
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 34-180
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000102
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 8 Region: 1644-1709
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000187
Family SH3-domain 0.0036
Further Details:      
 
Domain Number 9 Region: 190-308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000981
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 10 Region: 645-765
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000628
Family Spectrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020354   Gene: ENSCJAG00000006440   Transcript: ENSCJAT00000021504
Sequence length 1724
Comment pep:novel chromosome:C_jacchus3.2.1:15:72434414:72945062:-1 gene:ENSCJAG00000006440 transcript:ENSCJAT00000021504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRFWDWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFP
ARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPA
EIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHE
EWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAP
VEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHV
RKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMNS
MNAYVNINRIMSVASRLSEAGHYATQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFH
QKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDV
LQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVF
QQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAA
EQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQ
KEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEA
RDSAVSNNKTPHTSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEV
TAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIME
VQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQ
VLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQ
KAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLES
LEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKVRAHFRQSLFVFLKYIH
RNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQ
ALDWIQETGEFYLSTHTSAGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEK
GHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDRE
VKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPG
ILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPD
SNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKD
GLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLF
EISLVFSKEIKDSTGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLK
ASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGDG
SSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSTELTIQVGQTVELLERPSE
RPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVK
Download sequence
Identical sequences F7GRF9
ENSCJAP00000020354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]