SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020376 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020376
Domain Number 1 Region: 2692-2951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-58
Family Protein kinases, catalytic subunit 0.00000431
Further Details:      
 
Domain Number 2 Region: 1898-2094
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 1233-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2096-2218
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-33
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 5 Region: 1415-1533
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2585-2681
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-23
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 250-386
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1047-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 797-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 471-612
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2450-2514
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000927
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1584-1675
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000018
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 6-160
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000157
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 617-724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000984
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 164-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000484
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000020376
Domain Number - Region: 391-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.054
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020376   Gene: ENSCJAG00000010904   Transcript: ENSCJAT00000021527
Sequence length 2985
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:189011273:189398121:-1 gene:ENSCJAG00000010904 transcript:ENSCJAT00000021527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEV
CKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEF
ETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQD
ILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGS
GNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHN
KGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQI
RQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQD
LEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLD
VIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKS
LHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDF
VRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQT
TLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERK
IKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMN
NLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQH
RKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEK
THQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKT
SEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARR
NADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQ
YVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLL
IQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSL
QLDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYL
WEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADK
FQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKEL
LTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKT
LIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWV
GRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGR
RDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRR
GQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSV
SSNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHK
HKKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEE
GEEGADAVPLPPPMAIQQHSLLQPDPQDDKASSRLLVRPTSSETPSAAELVSAIEELVKS
KMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVE
TERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLE
DPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIK
PVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIV
AQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIK
VSCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNA
LTSPIEYQRNHAPSTSRSRPSRIPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPP
CVAPEASPSAPGRRPPSADAEGSEREAEPIPKMKVLESPRKCAANASGPSPDAPAKEARA
SLGALPLGKPRPGAASPLNSPLSSAVPSPLGKEPFPPSSPLQKGGSFWSSIPASPASRPG
SFTFPGDSDSLQRQTPRHAAPGKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLV
THDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVI
MENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYWKSREGLSNKVSVKLLNPN
YIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSD
LGEATLKIVGVTTEDDGIYTCTAVNDMGSASSSASLRVLGPGTDGIMVTWKDNFDSFYSE
VAELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQSLQHPLLIGLLDT
FETPTSYVLVLEMADQGRLLDCVGWGSLTEGKIRAHLGVAHLDLKPENILVDQSLAKPTI
KLADFGDAVQLNTTYYVHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSGVSPF
LDDSVEETCLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQA
GNGRSTGVLDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences F7GAF3
ENSCJAP00000020376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]