SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020380 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020380
Domain Number 1 Region: 2764-3037
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-58
Family Protein kinases, catalytic subunit 0.00000377
Further Details:      
 
Domain Number 2 Region: 1930-2126
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 1265-1443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2128-2250
Classification Level Classification E-value
Superfamily PH domain-like 9.92e-33
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 5 Region: 1447-1565
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2657-2753
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-23
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 282-418
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1079-1216
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 829-982
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 503-644
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2522-2586
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000955
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1616-1707
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000194
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 38-192
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 649-756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000948
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 196-312
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000497
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000020380
Domain Number - Region: 423-535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020380   Gene: ENSCJAG00000010904   Transcript: ENSCJAT00000021531
Sequence length 3071
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:189011276:189398131:-1 gene:ENSCJAG00000010904 transcript:ENSCJAT00000021531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGRYRRGSEEAAKDLADIAAVSDPGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPI
LTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQE
SFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLE
YNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKV
IKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQ
MWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHF
AMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMS
SIFHQKAEKYMSNVDSWCKACGEVDLPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKS
LLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQ
LCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKL
LEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWL
EELQKELLDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNK
TPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWND
ELSQQMNDFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELL
CDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGE
SMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRD
CAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKL
GPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQ
QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTS
TGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKR
YRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVKLRDAAHELNEEKR
KSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEI
YEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDE
IQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDA
MHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSG
RSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIR
EVIQERTIHLKGALKEPIHIPKTAPATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQN
TLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAA
EGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVSSNDASPPASVASLQPHMIGAQSSPGPK
RPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQD
ETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDPQD
DKASSRLLVRPTSSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDN
SLLSSSSPIDEMEERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDD
MKGKDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPK
SEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSE
LERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERR
IFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFALTSRTGDVVE
TFILHSSSPSVRQTWIHEINQILENQRNFLNALTSPIEYQRNHSGGGGGGGSGGGGGGGG
SGSSGAPSGGSGGHSSGPGSCGGAPSTSRSRPSRIPQPVRHHPPVLVSSAASSQAEADKM
SGTSTPGPSLPPCVAPEASPSAPGRRPPSADAEGSEREAEPIPKMKVLESPRKCAANASG
PSPDAPAKEARASLGALPLGKPRPGAASPLNSPLSSAVPSPLGKEPFPPSSPLQKGGSFW
SSIPASPASRPGSFTFPGDSDSLQRQTPRHAAPGKDTDRMSTCSSASEQSVQSTQSNGSE
SSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWI
PGFVLGHTSAVIMENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYWKSREGL
SNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTL
NNDGHYSISYSDLGEATLKIVGVTTEDDGIYTCTAVNDMGSASSSASLRVLGPGTDGIMV
TWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQS
LQHPLLIGLLDTFETPTSYVLVLEMADQGRLLDCVMGWGSLTEGKIRAHLGEXXXXXXXX
XXXXXAHLDLKPENILVDQSLAKPTIKLADFGDAVQLNTTYYVHQLLGNPEFAAPEIILG
NPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKEF
VCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGVLDTSRLTSFIERRKHQNDVRPIRSIK
NFLQSRLLPRV
Download sequence
Identical sequences F7G9U8
ENSCJAP00000020376 ENSCJAP00000020380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]