SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020441 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020441
Domain Number 1 Region: 57-168
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.66e-38
Family Frizzled cysteine-rich domain 0.0001
Further Details:      
 
Domain Number 2 Region: 183-307
Classification Level Classification E-value
Superfamily TIMP-like 1.33e-20
Family Netrin-like domain (NTR/C345C module) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020441   Gene: ENSCJAG00000011066   Transcript: ENSCJAT00000021598
Sequence length 313
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:38966237:39015640:-1 gene:ENSCJAG00000011066 transcript:ENSCJAT00000021598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRSAGGSRGAALGVLLALGAALLAAGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVC
LDRPIYPCRWLCEAVRDSCEPVMQFFGFHWPEMLKCDKFPEGDVCIAMTPPNATEASKPQ
GTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKK
DLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKM
KNHECPTFQSVFK
Download sequence
Identical sequences F7EDT7
ENSCJAP00000020434 ENSCJAP00000020441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]