SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020523 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020523
Domain Number 1 Region: 525-553,660-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020523   Gene: ENSCJAG00000011074   Transcript: ENSCJAT00000021689
Sequence length 885
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:27963421:27984419:-1 gene:ENSCJAG00000011074 transcript:ENSCJAT00000021689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLS
WLPKYKIKDYIVPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEVERLHVSATLACLT
AIIQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYTGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGS
CKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAVGRTLASKHG
YNVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGTYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPY
GVAVGVAFSVLVVIFQTQFRNGYALAQVMDTDIYVNPKTYSRAQDIQGIKIITYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKQRLRPTQQRKSLFMKTKTVSLQELQQ
DFENAPPTDPNNNQTPANGASVSYITFSPDSSSAARSEPPASAEAPDEPSDTLASVPPFV
TFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGS
LECNHVFPSIHDAVLFAQANARDVTPRRNFQGAPGDPELSLYDSEEDIPSYWDLEQEMFG
SMFHTETLTALEPLSSRGCYPYSSESLGSPVFTRQALAAVGKPPDHSTPPTSALSLAAEG
HLDFQLLQVSQKQKDKYNCAGLLCKLQKVSQGPHGSVSDGVRLSR
Download sequence
Identical sequences F7H1H6
ENSCJAP00000020523 ENSCJAP00000020523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]