SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020772 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020772
Domain Number 1 Region: 34-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-40
Family Frizzled cysteine-rich domain 0.000000217
Further Details:      
 
Domain Number 2 Region: 178-289
Classification Level Classification E-value
Superfamily TIMP-like 4.08e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020772   Gene: ENSCJAG00000011255   Transcript: ENSCJAT00000021956
Sequence length 325
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:35637915:35671574:1 gene:ENSCJAG00000011255 transcript:ENSCJAT00000021956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGSPGRMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
SGCLCPPLNVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLELSK
SDSSNSDSTQSQKSGRNSNPRQARN
Download sequence
Identical sequences A0A2K5CJZ5 F7GJL6
ENSCJAP00000020772 ENSCJAP00000020772 XP_012324037.1.9421 XP_012324038.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]