SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020845 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020845
Domain Number 1 Region: 158-541
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.48e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000736
Further Details:      
 
Domain Number 2 Region: 517-645
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.67e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000087
Further Details:      
 
Domain Number 3 Region: 64-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.09e-26
Family Thioltransferase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020845   Gene: ENSCJAG00000011289   Transcript: ENSCJAT00000022034
Sequence length 647
Comment pep:novel chromosome:C_jacchus3.2.1:15:70536356:70580925:1 gene:ENSCJAG00000011289 transcript:ENSCJAT00000022034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSESEILEQSPKSPGPGKAGDAPNRRPGHILGARVESPPGRRARLASPRPSSSSEAREE
LRRRLLGLIERSRVVIFSKSYCPHSTRVKELFSSLGVECYVLELDQADDGAKIQEVLLEI
TNQKTVPNIFVNKVHVGGCDQTFQAYQSGSLQKLLQEDSAYDYDLIVIGGGSGGLSCAKE
AAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALHDSRKFGWEY
NQQVKHSWETMTKAIQNHIRSLNFGYGLSLREKAVAYVNSYGEFVEHHKIKATNKKGQET
YYTAAQFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GFGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLWKFIPVMVQQLEKGSPGKLKVL
AKSTEGTETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVY
AVGDILEGKPELXXXXLLNGKYHKIRLCNLFVFQCDYINVPTTVFTPLEYGCCGLSEEKA
IEVYKKENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHNRVIGFHILGPNAGEVTQ
GFAAAMKCGLTKQLLDDTIGIHPTCGEVFMTLEITKSSGLDITQKGC
Download sequence
Identical sequences F7EQD2
ENSCJAP00000020845 ENSCJAP00000020845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]