SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021428 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021428
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 3.57e-49
Family Globins 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021428   Gene: ENSCJAG00000011647   Transcript: ENSCJAT00000022649
Sequence length 142
Comment pep:novel chromosome:C_jacchus3.2.1:12:193616:194462:1 gene:ENSCJAG00000011647 transcript:ENSCJAT00000022649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKSNVKAAWGKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences B0VX78
ENSCJAP00000021428 ENSCJAP00000021428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]