SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021478 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021478
Domain Number 1 Region: 306-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000327
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00096
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 44-96
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021478   Gene: ENSCJAG00000011666   Transcript: ENSCJAT00000022703
Sequence length 591
Comment pep:novel chromosome:C_jacchus3.2.1:22:38933810:38959583:1 gene:ENSCJAG00000011666 transcript:ENSCJAT00000022703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGGGGGSEVKCGGGRGASVPWDFLPGMVKAPSGPCLQAQRKEKSRNAARSRRGKE
NLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLAP
GRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGSS
VFDYIHPGDHSEVLEQLGLRAPTPGPPTPPSVSSSSSSSSSSSLADTPEIETSLTKVPPS
SLVRERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELP
LHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLD
KGQVMTGYYRWLQRTGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQ
LPASMTCEDASSPGPEPTEPEPPAEGKETASLEKEAPQTQGKRIKVEPVPRETEGSEDSG
DEDPSGHPAPPRPEFTSVIRAGALKQDPVRPWGLTPPGDPPPTLLHAGFLPPVVRGLCTP
GAIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGSAGTRLPRKGD
Download sequence
Identical sequences F6R0C1
ENSCJAP00000021478 ENSCJAP00000021478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]