SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021490 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021490
Domain Number 1 Region: 148-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.56e-33
Family G proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 381-504
Classification Level Classification E-value
Superfamily Translation proteins 9.28e-18
Family Elongation factors 0.0014
Further Details:      
 
Domain Number 3 Region: 478-563
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 9.46e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021490   Gene: ENSCJAG00000011652   Transcript: ENSCJAT00000022716
Sequence length 658
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:201070575:201096868:1 gene:ENSCJAG00000011652 transcript:ENSCJAT00000022716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERSRSAMDSPVPACMFAPEPRLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSPTSE
QYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVIL
LRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFAR
QKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDL
AGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMS
HKHLLQEETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGEN
LDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPD
PLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEF
EAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLH
IDQPASGVREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLMKRDEGGPSGGP
AVGAPPPGDEASSLGAGQPASSSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC
Download sequence
Identical sequences F6QFS5
ENSCJAP00000021466 ENSCJAP00000021490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]