SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022135 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022135
Domain Number 1 Region: 173-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000649
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000022135
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022135   Gene: ENSCJAG00000012019   Transcript: ENSCJAT00000023400
Sequence length 601
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:38243721:38287334:1 gene:ENSCJAG00000012019 transcript:ENSCJAT00000023400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAGAARRPRCCTSWRTRYPSHVASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTLNLKAATWKV
LHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLD
MKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDFDAVSKSIHTLLSKGQAVTGQYRFLA
RSGGYLWTQTQATVVSGGRGSQSESIICVHFLISRVEETGVVLSLEQTEQHSRRPIQRGS
PSQKDASNSGGSLDAPGPRILAFLHPPSMSEAALAADPRRFCSPDLRRLLGPILDGASVA
ATPSTPPATRRPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDVAQDADALDLE
MLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPAFEPSLLPRWGSDPR
LSCSSPSRGNPSASSLMAGARKRTLAQSSEGEDEGVELLGVRPPKRCPSPEPGNFLLFPL
SLSFLLTGGPAPGSLQDPSTPLLDLNEPLGLGPSLLSPYSDGDTDQPRGHFQPAAGSGQA
D
Download sequence
Identical sequences F6YAQ5
ENSCJAP00000022135 XP_008986513.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]