SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022163 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022163
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily TPR-like 1.73e-30
Family Tetratricopeptide repeat (TPR) 0.00000204
Further Details:      
 
Domain Number 2 Region: 220-299
Classification Level Classification E-value
Superfamily RING/U-box 1.85e-24
Family U-box 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022163   Gene: ENSCJAG00000012062   Transcript: ENSCJAT00000023429
Sequence length 303
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:701432:704081:1 gene:ENSCJAG00000012062 transcript:ENSCJAT00000023429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELKEC
QQNHEGDEDDSHVRAQQACIEAKHDRYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY
Download sequence
Identical sequences F6X127
ENSCJAP00000022163 ENSCJAP00000022163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]