SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022418 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000022418
Domain Number - Region: 72-114
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00471
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022418   Gene: ENSCJAG00000012217   Transcript: ENSCJAT00000023706
Sequence length 226
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:12120410:12124046:-1 gene:ENSCJAG00000012217 transcript:ENSCJAT00000023706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGAGPSRAMWQVLLLLALCATGARGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMW
DKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRM
ALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYRE
ERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV
Download sequence
Identical sequences F7HUB9
ENSCJAP00000022418 ENSCJAP00000022410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]