SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022723 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022723
Domain Number 1 Region: 221-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.46e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022723   Gene: ENSCJAG00000012389   Transcript: ENSCJAT00000024039
Sequence length 588
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:61081176:61096968:1 gene:ENSCJAG00000012389 transcript:ENSCJAT00000024039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIETLLEAARFLEWQAQQQQRAREEQERRRLEREREQEQKKANSLARLAHALPVEEPRI
EAPPLPLSPPAPPPAPPPALATPAPVTVIPIPVVTNSPQPLPPPPPLPPTAQPLPLVPRQ
PALVSTPGLSIKEPAPLPSRPQVPTPAPLLPDSKTTIPPTGSPKPLQPLPTPILTIAPHP
GVQPQLAPPQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECF
ETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELK
HELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHHPQ
PELLKPTMPPPSTTPAPLPPHPHPHPHSVALSPAHLPVQQPQTQQKTPLPAPPPQPAAPA
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHVAHIAPSAPSPAVQ
LAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSQPVAVSHIAHTLSHQQVNGTAG
LGSPATVMTKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
Download sequence
Identical sequences F7IFG5
ENSCJAP00000022696 ENSCJAP00000022723 XP_002747849.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]