SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022743 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022743
Domain Number 1 Region: 185-262
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000012
Family Gar1-like SnoRNP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022743   Gene: ENSCJAG00000012406   Transcript: ENSCJAT00000024063
Sequence length 463
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:28568804:28609815:1 gene:ENSCJAG00000012406 transcript:ENSCJAT00000024063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVEAAAAQLETLKFNGTGFGVGEGPAAASPGSATAPGTQPSLQSHEGSPDTGQTVEVK
PAGEQPLQPFLNAIPAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDHLETSESDSDS
DSETDSDSSSSSCVSLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILP
EDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYV
LRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALD
FSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFAEVHQNWNAHSSASEHSKGYRNREF
TRGFSRSRYPRFCHGRPLPQQFYNSEQMVSQETSGFPSQRQDNPIMPQYPFPPPMFDMHN
FSLCPPPPPPPPVNMRWATPNMAAHPLLNLPYGDSNSHFGPYY
Download sequence
Identical sequences F7ID05
ENSCJAP00000022743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]