SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022828 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022828
Domain Number 1 Region: 197-299,458-554
Classification Level Classification E-value
Superfamily RNI-like 1.57e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 74-168
Classification Level Classification E-value
Superfamily F-box domain 2.75e-19
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022828   Gene: ENSCJAG00000012393   Transcript: ENSCJAT00000024151
Sequence length 565
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:175707633:175749431:1 gene:ENSCJAG00000012393 transcript:ENSCJAT00000024151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEERQKFFKY
SVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWK
HLYPVHWARGDWYSGPATELDTEPDEEWVKNRKDESRAFHDWDEDADIDESEESAEESIA
ISIAQMEKRLLHGLIHNILPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQT
DISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLKTSMSKI
TSTTWKNKDITMQSTKQFTCLHDLNNKGIGEEIDNEHPWSKPVSSENFTSPYVWMLDAED
LADIEDAVEWRHRNVESLCVMETASNFSCSTSCCYNKDIVGLRTSVCWQQHCASPAFAYC
GHSFCCTGTALRTMSALPESSAMCRKASRTRLPREKDLIYFGSEKSDQETGRVLLFLSLS
GCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNIN
GPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences F7HWI0
ENSCJAP00000022828 ENSCJAP00000022828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]