SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022943 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000022943
Domain Number - Region: 30-107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.018
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022943   Gene: ENSCJAG00000012534   Transcript: ENSCJAT00000024275
Sequence length 132
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:95806571:95816925:1 gene:ENSCJAG00000012534 transcript:ENSCJAT00000024275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELIDQ
LAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEGLCKVEAE
QNEFIDQFIFQK
Download sequence
Identical sequences F7ICX0
ENSCJAP00000022943 ENSCJAP00000022943 XP_002748308.1.60252 XP_008995459.1.60252 XP_017828065.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]