SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023021 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023021
Domain Number 1 Region: 312-718
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.66e-111
Family Phosphofructokinase 0.0000106
Further Details:      
 
Domain Number 2 Region: 1-319
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.97e-98
Family Phosphofructokinase 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023021   Gene: ENSCJAG00000017630   Transcript: ENSCJAT00000024356
Sequence length 752
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:48131735:48157495:1 gene:ENSCJAG00000017630 transcript:ENSCJAT00000024356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTVIGSAR
CKAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGSLLEELVAEGKISES
TARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVM
GRHCGYLALVSALASGADWLFIPESPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAID
RNGKPILSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEAT
PDTPACVVSLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEAIQLRGRSFENNWNIYKLL
AHQKLSKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISQGHTVYVVHDGFEGLAKGQVQ
EVGWHDVAGWLGRGGSMLGTKRTLPKGHLESIVENIRTYGIHALLAVGGFEAYEGVLQLV
EARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFV
VETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKANVEHMTEKMKTDIQRGLVLRNE
KCHDHYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWVSE
KLREVYRKGRVFANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLML
KMLAHYRISMAAYVSGELEHVTRRTLSMETGF
Download sequence
Identical sequences F7IIG0
ENSCJAP00000023021 ENSCJAP00000023021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]