SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023045 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023045
Domain Number 1 Region: 82-425
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.15e-108
Family Phosphofructokinase 0.000000283
Further Details:      
 
Domain Number 2 Region: 614-822
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.75e-48
Family Phosphofructokinase 0.00038
Further Details:      
 
Domain Number 3 Region: 457-541
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.98e-20
Family Phosphofructokinase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023045   Gene: ENSCJAG00000012528   Transcript: ENSCJAT00000024381
Sequence length 849
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:507232:554353:1 gene:ENSCJAG00000012528 transcript:ENSCJAT00000024381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDEFHLKFFMCVIQSRQLVRTRQRTAGEASTSSTFIPKTDTLKSLDTTDDPDTVGSIP
IFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHE
GYQGLVDGGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNL
CVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTD
MTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPEC
PPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRV
TVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQ
EVERQDGAAGDVGKEHSGLSEGAXSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPA
AGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKSG
ESPPPFHPFAAQYYLYALNTIYLYGESPPPLPSLLALNTIYLYGESPPPLPSLLALNTIY
LYGESPPPLPSLLALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGAD
AAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGI
FDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVL
GMRKRALLFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHIS
RKRSGEAGV
Download sequence
Identical sequences F7IG21
ENSCJAP00000023045 ENSCJAP00000023045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]