SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023050 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023050
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-19
Family RING finger domain, C3HC4 0.0000112
Further Details:      
 
Domain Number 2 Region: 103-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-16
Family Canonical RBD 0.0000113
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023050
Domain Number - Region: 191-218
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0145
Family CCCH zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023050   Gene: ENSCJAG00000012532   Transcript: ENSCJAT00000024386
Sequence length 236
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:110677345:110822936:1 gene:ENSCJAG00000012532 transcript:ENSCJAT00000024386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELRDPCSRYSSVFRKQFRLSSR
Download sequence
Identical sequences B3KQ99 F7IDP7
ENSCJAP00000023050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]