SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023386 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023386
Domain Number 1 Region: 529-561,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023386   Gene: ENSCJAG00000012752   Transcript: ENSCJAT00000024743
Sequence length 744
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:71751134:71795571:-1 gene:ENSCJAG00000012752 transcript:ENSCJAT00000024743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHQKDKIPDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVMSHHMSSISTKVFNPTGLAFAMLAAVPPIFGLYSSFYPVI
MYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS
VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIF
SVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMGT
GISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTL
ANKHGYQVDGNQEKELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASL
MILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSS
LFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQ
KNAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANMANATVVKADAVD
GEDATKPEEEDGEIKYPPIVIKSTFPEEMQRFMPPGDNIHTVILDFTQVNFIDSVGVKTV
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALA
EQEASAPPLQEDLEPNATPSTPEA
Download sequence
Identical sequences F7HZB7
ENSCJAP00000023384 ENSCJAP00000023386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]