SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023697 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023697
Domain Number 1 Region: 257-412
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 636-750
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 37-161
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 166-275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000101
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 5 Region: 713-859
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000018
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023697
Domain Number - Region: 533-647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00128
Family Spectrin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023697   Gene: ENSCJAG00000012842   Transcript: ENSCJAT00000025069
Sequence length 911
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:153039874:153106933:-1 gene:ENSCJAG00000012842 transcript:ENSCJAT00000025069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKVSQNGDILIEEMIEKLRKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYK
LGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSILRTWLAHIESELAKPIVYDSCN
SEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDR
RWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKISERTAAFPSSSGVIYTVAKEE
LKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTS
ILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISL
NHNKIEQIIAQGEQLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDD
EHDLSDRELELEDSAALSDLHWQDRSADSVLSPQPSSNPSLSLAQPLRSERSGRDTPASV
DSIPLEWDHDYDLSRDLESAVSRALPSEDEDGQDDKDFYLRGAVGLSGDHSALESQIRQL
GRALDESRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSGSIDSVKRLEHKLKEEE
ESLPGFVNLHSTETQMAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGD
TEEELEHLQHLELSTDIHTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESQ
DLQDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVP
IDPNLDAEVLQDHHKQLMQIRRELLESQLRVASLQDMSCQLLVNAEGADCLEAKEKVHVI
GNRLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKT
VHKRWLRFLPF
Download sequence
Identical sequences F7GXJ6
ENSCJAP00000023682 ENSCJAP00000023697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]